实现基础web服务器

This commit is contained in:
2025-09-07 19:57:25 +08:00
parent f9bc4d6326
commit c377a0784d
1234 changed files with 548132 additions and 15 deletions

View File

@@ -0,0 +1,38 @@
// Derived from Inferno utils/6l/l.h and related files.
// https://bitbucket.org/inferno-os/inferno-os/src/master/utils/6l/l.h
//
// Copyright © 1994-1999 Lucent Technologies Inc. All rights reserved.
// Portions Copyright © 1995-1997 C H Forsyth (forsyth@terzarima.net)
// Portions Copyright © 1997-1999 Vita Nuova Limited
// Portions Copyright © 2000-2007 Vita Nuova Holdings Limited (www.vitanuova.com)
// Portions Copyright © 2004,2006 Bruce Ellis
// Portions Copyright © 2005-2007 C H Forsyth (forsyth@terzarima.net)
// Revisions Copyright © 2000-2007 Lucent Technologies Inc. and others
// Portions Copyright © 2009 The Go Authors. All rights reserved.
//
// Permission is hereby granted, free of charge, to any person obtaining a copy
// of this software and associated documentation files (the "Software"), to deal
// in the Software without restriction, including without limitation the rights
// to use, copy, modify, merge, publish, distribute, sublicense, and/or sell
// copies of the Software, and to permit persons to whom the Software is
// furnished to do so, subject to the following conditions:
//
// The above copyright notice and this permission notice shall be included in
// all copies or substantial portions of the Software.
//
// THE SOFTWARE IS PROVIDED "AS IS", WITHOUT WARRANTY OF ANY KIND, EXPRESS OR
// IMPLIED, INCLUDING BUT NOT LIMITED TO THE WARRANTIES OF MERCHANTABILITY,
// FITNESS FOR A PARTICULAR PURPOSE AND NONINFRINGEMENT. IN NO EVENT SHALL THE
// AUTHORS OR COPYRIGHT HOLDERS BE LIABLE FOR ANY CLAIM, DAMAGES OR OTHER
// LIABILITY, WHETHER IN AN ACTION OF CONTRACT, TORT OR OTHERWISE, ARISING FROM,
// OUT OF OR IN CONNECTION WITH THE SOFTWARE OR THE USE OR OTHER DEALINGS IN
// THE SOFTWARE.
package objabi
// Auto.name
const (
A_AUTO = 1 + iota
A_PARAM
A_DELETED_AUTO
)

View File

@@ -0,0 +1,162 @@
// Copyright 2015 The Go Authors. All rights reserved.
// Use of this source code is governed by a BSD-style
// license that can be found in the LICENSE file.
package objabi
import (
"flag"
"fmt"
"io"
"io/ioutil"
"log"
"os"
"strconv"
"strings"
)
func Flagcount(name, usage string, val *int) {
flag.Var((*count)(val), name, usage)
}
func Flagfn1(name, usage string, f func(string)) {
flag.Var(fn1(f), name, usage)
}
func Flagprint(w io.Writer) {
flag.CommandLine.SetOutput(w)
flag.PrintDefaults()
}
func Flagparse(usage func()) {
flag.Usage = usage
os.Args = expandArgs(os.Args)
flag.Parse()
}
// expandArgs expands "response files" arguments in the provided slice.
//
// A "response file" argument starts with '@' and the rest of that
// argument is a filename with CR-or-CRLF-separated arguments. Each
// argument in the named files can also contain response file
// arguments. See Issue 18468.
//
// The returned slice 'out' aliases 'in' iff the input did not contain
// any response file arguments.
//
// TODO: handle relative paths of recursive expansions in different directories?
// Is there a spec for this? Are relative paths allowed?
func expandArgs(in []string) (out []string) {
// out is nil until we see a "@" argument.
for i, s := range in {
if strings.HasPrefix(s, "@") {
if out == nil {
out = make([]string, 0, len(in)*2)
out = append(out, in[:i]...)
}
slurp, err := ioutil.ReadFile(s[1:])
if err != nil {
log.Fatal(err)
}
args := strings.Split(strings.TrimSpace(strings.Replace(string(slurp), "\r", "", -1)), "\n")
out = append(out, expandArgs(args)...)
} else if out != nil {
out = append(out, s)
}
}
if out == nil {
return in
}
return
}
func AddVersionFlag() {
flag.Var(versionFlag{}, "V", "print version and exit")
}
var buildID string // filled in by linker
type versionFlag struct{}
func (versionFlag) IsBoolFlag() bool { return true }
func (versionFlag) Get() interface{} { return nil }
func (versionFlag) String() string { return "" }
func (versionFlag) Set(s string) error {
name := os.Args[0]
name = name[strings.LastIndex(name, `/`)+1:]
name = name[strings.LastIndex(name, `\`)+1:]
name = strings.TrimSuffix(name, ".exe")
// If there's an active experiment, include that,
// to distinguish go1.10.2 with an experiment
// from go1.10.2 without an experiment.
p := Expstring()
if p == DefaultExpstring() {
p = ""
}
sep := ""
if p != "" {
sep = " "
}
// The go command invokes -V=full to get a unique identifier
// for this tool. It is assumed that the release version is sufficient
// for releases, but during development we include the full
// build ID of the binary, so that if the compiler is changed and
// rebuilt, we notice and rebuild all packages.
if s == "full" {
if strings.HasPrefix(Version, "devel") {
p += " buildID=" + buildID
}
}
fmt.Printf("%s version %s%s%s\n", name, Version, sep, p)
os.Exit(0)
return nil
}
// count is a flag.Value that is like a flag.Bool and a flag.Int.
// If used as -name, it increments the count, but -name=x sets the count.
// Used for verbose flag -v.
type count int
func (c *count) String() string {
return fmt.Sprint(int(*c))
}
func (c *count) Set(s string) error {
switch s {
case "true":
*c++
case "false":
*c = 0
default:
n, err := strconv.Atoi(s)
if err != nil {
return fmt.Errorf("invalid count %q", s)
}
*c = count(n)
}
return nil
}
func (c *count) Get() interface{} {
return int(*c)
}
func (c *count) IsBoolFlag() bool {
return true
}
func (c *count) IsCountFlag() bool {
return true
}
type fn1 func(string)
func (f fn1) Set(s string) error {
f(s)
return nil
}
func (f fn1) String() string { return "" }

View File

@@ -0,0 +1,54 @@
// Copyright 2013 The Go Authors. All rights reserved.
// Use of this source code is governed by a BSD-style
// license that can be found in the LICENSE file.
package objabi
// This file defines the IDs for PCDATA and FUNCDATA instructions
// in Go binaries.
//
// These must agree with ../../../runtime/funcdata.h and
// ../../../runtime/symtab.go.
const (
PCDATA_RegMapIndex = 0 // if !go115ReduceLiveness
PCDATA_UnsafePoint = 0 // if go115ReduceLiveness
PCDATA_StackMapIndex = 1
PCDATA_InlTreeIndex = 2
FUNCDATA_ArgsPointerMaps = 0
FUNCDATA_LocalsPointerMaps = 1
FUNCDATA_RegPointerMaps = 2 // if !go115ReduceLiveness
FUNCDATA_StackObjects = 3
FUNCDATA_InlTree = 4
FUNCDATA_OpenCodedDeferInfo = 5
// ArgsSizeUnknown is set in Func.argsize to mark all functions
// whose argument size is unknown (C vararg functions, and
// assembly code without an explicit specification).
// This value is generated by the compiler, assembler, or linker.
ArgsSizeUnknown = -0x80000000
)
// Special PCDATA values.
const (
// PCDATA_RegMapIndex values.
//
// Only if !go115ReduceLiveness.
PCDATA_RegMapUnsafe = PCDATA_UnsafePointUnsafe // Unsafe for async preemption
// PCDATA_UnsafePoint values.
PCDATA_UnsafePointSafe = -1 // Safe for async preemption
PCDATA_UnsafePointUnsafe = -2 // Unsafe for async preemption
// PCDATA_Restart1(2) apply on a sequence of instructions, within
// which if an async preemption happens, we should back off the PC
// to the start of the sequence when resuming.
// We need two so we can distinguish the start/end of the sequence
// in case that two sequences are next to each other.
PCDATA_Restart1 = -3
PCDATA_Restart2 = -4
// Like PCDATA_Restart1, but back to function entry if async preempted.
PCDATA_RestartAtEntry = -5
)

View File

@@ -0,0 +1,100 @@
// Copyright 2018 The Go Authors. All rights reserved.
// Use of this source code is governed by a BSD-style
// license that can be found in the LICENSE file.
package objabi
// A FuncID identifies particular functions that need to be treated
// specially by the runtime.
// Note that in some situations involving plugins, there may be multiple
// copies of a particular special runtime function.
// Note: this list must match the list in runtime/symtab.go.
type FuncID uint8
const (
FuncID_normal FuncID = iota // not a special function
FuncID_runtime_main
FuncID_goexit
FuncID_jmpdefer
FuncID_mcall
FuncID_morestack
FuncID_mstart
FuncID_rt0_go
FuncID_asmcgocall
FuncID_sigpanic
FuncID_runfinq
FuncID_gcBgMarkWorker
FuncID_systemstack_switch
FuncID_systemstack
FuncID_cgocallback_gofunc
FuncID_gogo
FuncID_externalthreadhandler
FuncID_debugCallV1
FuncID_gopanic
FuncID_panicwrap
FuncID_handleAsyncEvent
FuncID_asyncPreempt
FuncID_wrapper // any autogenerated code (hash/eq algorithms, method wrappers, etc.)
)
// Get the function ID for the named function in the named file.
// The function should be package-qualified.
func GetFuncID(name string, isWrapper bool) FuncID {
if isWrapper {
return FuncID_wrapper
}
switch name {
case "runtime.main":
return FuncID_runtime_main
case "runtime.goexit":
return FuncID_goexit
case "runtime.jmpdefer":
return FuncID_jmpdefer
case "runtime.mcall":
return FuncID_mcall
case "runtime.morestack":
return FuncID_morestack
case "runtime.mstart":
return FuncID_mstart
case "runtime.rt0_go":
return FuncID_rt0_go
case "runtime.asmcgocall":
return FuncID_asmcgocall
case "runtime.sigpanic":
return FuncID_sigpanic
case "runtime.runfinq":
return FuncID_runfinq
case "runtime.gcBgMarkWorker":
return FuncID_gcBgMarkWorker
case "runtime.systemstack_switch":
return FuncID_systemstack_switch
case "runtime.systemstack":
return FuncID_systemstack
case "runtime.cgocallback_gofunc":
return FuncID_cgocallback_gofunc
case "runtime.gogo":
return FuncID_gogo
case "runtime.externalthreadhandler":
return FuncID_externalthreadhandler
case "runtime.debugCallV1":
return FuncID_debugCallV1
case "runtime.gopanic":
return FuncID_gopanic
case "runtime.panicwrap":
return FuncID_panicwrap
case "runtime.handleAsyncEvent":
return FuncID_handleAsyncEvent
case "runtime.asyncPreempt":
return FuncID_asyncPreempt
case "runtime.deferreturn":
// Don't show in the call stack (used when invoking defer functions)
return FuncID_wrapper
case "runtime.runOpenDeferFrame":
// Don't show in the call stack (used when invoking defer functions)
return FuncID_wrapper
case "runtime.reflectcallSave":
// Don't show in the call stack (used when invoking defer functions)
return FuncID_wrapper
}
return FuncID_normal
}

View File

@@ -0,0 +1,109 @@
// Derived from Inferno utils/6l/l.h and related files.
// https://bitbucket.org/inferno-os/inferno-os/src/master/utils/6l/l.h
//
// Copyright © 1994-1999 Lucent Technologies Inc. All rights reserved.
// Portions Copyright © 1995-1997 C H Forsyth (forsyth@terzarima.net)
// Portions Copyright © 1997-1999 Vita Nuova Limited
// Portions Copyright © 2000-2007 Vita Nuova Holdings Limited (www.vitanuova.com)
// Portions Copyright © 2004,2006 Bruce Ellis
// Portions Copyright © 2005-2007 C H Forsyth (forsyth@terzarima.net)
// Revisions Copyright © 2000-2007 Lucent Technologies Inc. and others
// Portions Copyright © 2009 The Go Authors. All rights reserved.
//
// Permission is hereby granted, free of charge, to any person obtaining a copy
// of this software and associated documentation files (the "Software"), to deal
// in the Software without restriction, including without limitation the rights
// to use, copy, modify, merge, publish, distribute, sublicense, and/or sell
// copies of the Software, and to permit persons to whom the Software is
// furnished to do so, subject to the following conditions:
//
// The above copyright notice and this permission notice shall be included in
// all copies or substantial portions of the Software.
//
// THE SOFTWARE IS PROVIDED "AS IS", WITHOUT WARRANTY OF ANY KIND, EXPRESS OR
// IMPLIED, INCLUDING BUT NOT LIMITED TO THE WARRANTIES OF MERCHANTABILITY,
// FITNESS FOR A PARTICULAR PURPOSE AND NONINFRINGEMENT. IN NO EVENT SHALL THE
// AUTHORS OR COPYRIGHT HOLDERS BE LIABLE FOR ANY CLAIM, DAMAGES OR OTHER
// LIABILITY, WHETHER IN AN ACTION OF CONTRACT, TORT OR OTHERWISE, ARISING FROM,
// OUT OF OR IN CONNECTION WITH THE SOFTWARE OR THE USE OR OTHER DEALINGS IN
// THE SOFTWARE.
package objabi
import "fmt"
// HeadType is the executable header type.
type HeadType uint8
const (
Hunknown HeadType = iota
Hdarwin
Hdragonfly
Hfreebsd
Hjs
Hlinux
Hnetbsd
Hopenbsd
Hplan9
Hsolaris
Hwindows
Haix
)
func (h *HeadType) Set(s string) error {
switch s {
case "aix":
*h = Haix
case "darwin":
*h = Hdarwin
case "dragonfly":
*h = Hdragonfly
case "freebsd":
*h = Hfreebsd
case "js":
*h = Hjs
case "linux", "android":
*h = Hlinux
case "netbsd":
*h = Hnetbsd
case "openbsd":
*h = Hopenbsd
case "plan9":
*h = Hplan9
case "illumos", "solaris":
*h = Hsolaris
case "windows":
*h = Hwindows
default:
return fmt.Errorf("invalid headtype: %q", s)
}
return nil
}
func (h *HeadType) String() string {
switch *h {
case Haix:
return "aix"
case Hdarwin:
return "darwin"
case Hdragonfly:
return "dragonfly"
case Hfreebsd:
return "freebsd"
case Hjs:
return "js"
case Hlinux:
return "linux"
case Hnetbsd:
return "netbsd"
case Hopenbsd:
return "openbsd"
case Hplan9:
return "plan9"
case Hsolaris:
return "solaris"
case Hwindows:
return "windows"
}
return fmt.Sprintf("HeadType(%d)", *h)
}

View File

@@ -0,0 +1,114 @@
// Copyright 2009 The Go Authors. All rights reserved.
// Use of this source code is governed by a BSD-style
// license that can be found in the LICENSE file.
package objabi
import (
"os"
"path/filepath"
"strings"
)
// WorkingDir returns the current working directory
// (or "/???" if the directory cannot be identified),
// with "/" as separator.
func WorkingDir() string {
var path string
path, _ = os.Getwd()
if path == "" {
path = "/???"
}
return filepath.ToSlash(path)
}
// AbsFile returns the absolute filename for file in the given directory,
// as rewritten by the rewrites argument.
// For unrewritten paths, AbsFile rewrites a leading $GOROOT prefix to the literal "$GOROOT".
// If the resulting path is the empty string, the result is "??".
//
// The rewrites argument is a ;-separated list of rewrites.
// Each rewrite is of the form "prefix" or "prefix=>replace",
// where prefix must match a leading sequence of path elements
// and is either removed entirely or replaced by the replacement.
func AbsFile(dir, file, rewrites string) string {
abs := file
if dir != "" && !filepath.IsAbs(file) {
abs = filepath.Join(dir, file)
}
start := 0
for i := 0; i <= len(rewrites); i++ {
if i == len(rewrites) || rewrites[i] == ';' {
if new, ok := applyRewrite(abs, rewrites[start:i]); ok {
abs = new
goto Rewritten
}
start = i + 1
}
}
if hasPathPrefix(abs, GOROOT) {
abs = "$GOROOT" + abs[len(GOROOT):]
}
Rewritten:
if abs == "" {
abs = "??"
}
return abs
}
// applyRewrite applies the rewrite to the path,
// returning the rewritten path and a boolean
// indicating whether the rewrite applied at all.
func applyRewrite(path, rewrite string) (string, bool) {
prefix, replace := rewrite, ""
if j := strings.LastIndex(rewrite, "=>"); j >= 0 {
prefix, replace = rewrite[:j], rewrite[j+len("=>"):]
}
if prefix == "" || !hasPathPrefix(path, prefix) {
return path, false
}
if len(path) == len(prefix) {
return replace, true
}
if replace == "" {
return path[len(prefix)+1:], true
}
return replace + path[len(prefix):], true
}
// Does s have t as a path prefix?
// That is, does s == t or does s begin with t followed by a slash?
// For portability, we allow ASCII case folding, so that hasPathPrefix("a/b/c", "A/B") is true.
// Similarly, we allow slash folding, so that hasPathPrefix("a/b/c", "a\\b") is true.
// We do not allow full Unicode case folding, for fear of causing more confusion
// or harm than good. (For an example of the kinds of things that can go wrong,
// see http://article.gmane.org/gmane.linux.kernel/1853266.)
func hasPathPrefix(s string, t string) bool {
if len(t) > len(s) {
return false
}
var i int
for i = 0; i < len(t); i++ {
cs := int(s[i])
ct := int(t[i])
if 'A' <= cs && cs <= 'Z' {
cs += 'a' - 'A'
}
if 'A' <= ct && ct <= 'Z' {
ct += 'a' - 'A'
}
if cs == '\\' {
cs = '/'
}
if ct == '\\' {
ct = '/'
}
if cs != ct {
return false
}
}
return i >= len(s) || s[i] == '/' || s[i] == '\\'
}

View File

@@ -0,0 +1,41 @@
// Copyright 2017 The Go Authors. All rights reserved.
// Use of this source code is governed by a BSD-style
// license that can be found in the LICENSE file.
package objabi
import "strings"
// PathToPrefix converts raw string to the prefix that will be used in the
// symbol table. All control characters, space, '%' and '"', as well as
// non-7-bit clean bytes turn into %xx. The period needs escaping only in the
// last segment of the path, and it makes for happier users if we escape that as
// little as possible.
func PathToPrefix(s string) string {
slash := strings.LastIndex(s, "/")
// check for chars that need escaping
n := 0
for r := 0; r < len(s); r++ {
if c := s[r]; c <= ' ' || (c == '.' && r > slash) || c == '%' || c == '"' || c >= 0x7F {
n++
}
}
// quick exit
if n == 0 {
return s
}
// escape
const hex = "0123456789abcdef"
p := make([]byte, 0, len(s)+2*n)
for r := 0; r < len(s); r++ {
if c := s[r]; c <= ' ' || (c == '.' && r > slash) || c == '%' || c == '"' || c >= 0x7F {
p = append(p, '%', hex[c>>4], hex[c&0xF])
} else {
p = append(p, c)
}
}
return string(p)
}

View File

@@ -0,0 +1,269 @@
// Derived from Inferno utils/6l/l.h and related files.
// https://bitbucket.org/inferno-os/inferno-os/src/master/utils/6l/l.h
//
// Copyright © 1994-1999 Lucent Technologies Inc. All rights reserved.
// Portions Copyright © 1995-1997 C H Forsyth (forsyth@terzarima.net)
// Portions Copyright © 1997-1999 Vita Nuova Limited
// Portions Copyright © 2000-2007 Vita Nuova Holdings Limited (www.vitanuova.com)
// Portions Copyright © 2004,2006 Bruce Ellis
// Portions Copyright © 2005-2007 C H Forsyth (forsyth@terzarima.net)
// Revisions Copyright © 2000-2007 Lucent Technologies Inc. and others
// Portions Copyright © 2009 The Go Authors. All rights reserved.
//
// Permission is hereby granted, free of charge, to any person obtaining a copy
// of this software and associated documentation files (the "Software"), to deal
// in the Software without restriction, including without limitation the rights
// to use, copy, modify, merge, publish, distribute, sublicense, and/or sell
// copies of the Software, and to permit persons to whom the Software is
// furnished to do so, subject to the following conditions:
//
// The above copyright notice and this permission notice shall be included in
// all copies or substantial portions of the Software.
//
// THE SOFTWARE IS PROVIDED "AS IS", WITHOUT WARRANTY OF ANY KIND, EXPRESS OR
// IMPLIED, INCLUDING BUT NOT LIMITED TO THE WARRANTIES OF MERCHANTABILITY,
// FITNESS FOR A PARTICULAR PURPOSE AND NONINFRINGEMENT. IN NO EVENT SHALL THE
// AUTHORS OR COPYRIGHT HOLDERS BE LIABLE FOR ANY CLAIM, DAMAGES OR OTHER
// LIABILITY, WHETHER IN AN ACTION OF CONTRACT, TORT OR OTHERWISE, ARISING FROM,
// OUT OF OR IN CONNECTION WITH THE SOFTWARE OR THE USE OR OTHER DEALINGS IN
// THE SOFTWARE.
package objabi
type RelocType int16
//go:generate stringer -type=RelocType
const (
R_ADDR RelocType = 1 + iota
// R_ADDRPOWER relocates a pair of "D-form" instructions (instructions with 16-bit
// immediates in the low half of the instruction word), usually addis followed by
// another add or a load, inserting the "high adjusted" 16 bits of the address of
// the referenced symbol into the immediate field of the first instruction and the
// low 16 bits into that of the second instruction.
R_ADDRPOWER
// R_ADDRARM64 relocates an adrp, add pair to compute the address of the
// referenced symbol.
R_ADDRARM64
// R_ADDRMIPS (only used on mips/mips64) resolves to the low 16 bits of an external
// address, by encoding it into the instruction.
R_ADDRMIPS
// R_ADDROFF resolves to a 32-bit offset from the beginning of the section
// holding the data being relocated to the referenced symbol.
R_ADDROFF
// R_WEAKADDROFF resolves just like R_ADDROFF but is a weak relocation.
// A weak relocation does not make the symbol it refers to reachable,
// and is only honored by the linker if the symbol is in some other way
// reachable.
R_WEAKADDROFF
R_SIZE
R_CALL
R_CALLARM
R_CALLARM64
R_CALLIND
R_CALLPOWER
// R_CALLMIPS (only used on mips64) resolves to non-PC-relative target address
// of a CALL (JAL) instruction, by encoding the address into the instruction.
R_CALLMIPS
// R_CALLRISCV marks RISC-V CALLs for stack checking.
R_CALLRISCV
R_CONST
R_PCREL
// R_TLS_LE, used on 386, amd64, and ARM, resolves to the offset of the
// thread-local symbol from the thread local base and is used to implement the
// "local exec" model for tls access (r.Sym is not set on intel platforms but is
// set to a TLS symbol -- runtime.tlsg -- in the linker when externally linking).
R_TLS_LE
// R_TLS_IE, used 386, amd64, and ARM resolves to the PC-relative offset to a GOT
// slot containing the offset from the thread-local symbol from the thread local
// base and is used to implemented the "initial exec" model for tls access (r.Sym
// is not set on intel platforms but is set to a TLS symbol -- runtime.tlsg -- in
// the linker when externally linking).
R_TLS_IE
R_GOTOFF
R_PLT0
R_PLT1
R_PLT2
R_USEFIELD
// R_USETYPE resolves to an *rtype, but no relocation is created. The
// linker uses this as a signal that the pointed-to type information
// should be linked into the final binary, even if there are no other
// direct references. (This is used for types reachable by reflection.)
R_USETYPE
// R_METHODOFF resolves to a 32-bit offset from the beginning of the section
// holding the data being relocated to the referenced symbol.
// It is a variant of R_ADDROFF used when linking from the uncommonType of a
// *rtype, and may be set to zero by the linker if it determines the method
// text is unreachable by the linked program.
R_METHODOFF
R_POWER_TOC
R_GOTPCREL
// R_JMPMIPS (only used on mips64) resolves to non-PC-relative target address
// of a JMP instruction, by encoding the address into the instruction.
// The stack nosplit check ignores this since it is not a function call.
R_JMPMIPS
// R_DWARFSECREF resolves to the offset of the symbol from its section.
// Target of relocation must be size 4 (in current implementation).
R_DWARFSECREF
// R_DWARFFILEREF resolves to an index into the DWARF .debug_line
// file table for the specified file symbol. Must be applied to an
// attribute of form DW_FORM_data4.
R_DWARFFILEREF
// Platform dependent relocations. Architectures with fixed width instructions
// have the inherent issue that a 32-bit (or 64-bit!) displacement cannot be
// stuffed into a 32-bit instruction, so an address needs to be spread across
// several instructions, and in turn this requires a sequence of relocations, each
// updating a part of an instruction. This leads to relocation codes that are
// inherently processor specific.
// Arm64.
// Set a MOV[NZ] immediate field to bits [15:0] of the offset from the thread
// local base to the thread local variable defined by the referenced (thread
// local) symbol. Error if the offset does not fit into 16 bits.
R_ARM64_TLS_LE
// Relocates an ADRP; LD64 instruction sequence to load the offset between
// the thread local base and the thread local variable defined by the
// referenced (thread local) symbol from the GOT.
R_ARM64_TLS_IE
// R_ARM64_GOTPCREL relocates an adrp, ld64 pair to compute the address of the GOT
// slot of the referenced symbol.
R_ARM64_GOTPCREL
// R_ARM64_GOT resolves a GOT-relative instruction sequence, usually an adrp
// followed by another ld instruction.
R_ARM64_GOT
// R_ARM64_PCREL resolves a PC-relative addresses instruction sequence, usually an
// adrp followed by another add instruction.
R_ARM64_PCREL
// R_ARM64_LDST8 sets a LD/ST immediate value to bits [11:0] of a local address.
R_ARM64_LDST8
// R_ARM64_LDST32 sets a LD/ST immediate value to bits [11:2] of a local address.
R_ARM64_LDST32
// R_ARM64_LDST64 sets a LD/ST immediate value to bits [11:3] of a local address.
R_ARM64_LDST64
// R_ARM64_LDST128 sets a LD/ST immediate value to bits [11:4] of a local address.
R_ARM64_LDST128
// PPC64.
// R_POWER_TLS_LE is used to implement the "local exec" model for tls
// access. It resolves to the offset of the thread-local symbol from the
// thread pointer (R13) and inserts this value into the low 16 bits of an
// instruction word.
R_POWER_TLS_LE
// R_POWER_TLS_IE is used to implement the "initial exec" model for tls access. It
// relocates a D-form, DS-form instruction sequence like R_ADDRPOWER_DS. It
// inserts to the offset of GOT slot for the thread-local symbol from the TOC (the
// GOT slot is filled by the dynamic linker with the offset of the thread-local
// symbol from the thread pointer (R13)).
R_POWER_TLS_IE
// R_POWER_TLS marks an X-form instruction such as "MOVD 0(R13)(R31*1), g" as
// accessing a particular thread-local symbol. It does not affect code generation
// but is used by the system linker when relaxing "initial exec" model code to
// "local exec" model code.
R_POWER_TLS
// R_ADDRPOWER_DS is similar to R_ADDRPOWER above, but assumes the second
// instruction is a "DS-form" instruction, which has an immediate field occupying
// bits [15:2] of the instruction word. Bits [15:2] of the address of the
// relocated symbol are inserted into this field; it is an error if the last two
// bits of the address are not 0.
R_ADDRPOWER_DS
// R_ADDRPOWER_PCREL relocates a D-form, DS-form instruction sequence like
// R_ADDRPOWER_DS but inserts the offset of the GOT slot for the referenced symbol
// from the TOC rather than the symbol's address.
R_ADDRPOWER_GOT
// R_ADDRPOWER_PCREL relocates two D-form instructions like R_ADDRPOWER, but
// inserts the displacement from the place being relocated to the address of the
// relocated symbol instead of just its address.
R_ADDRPOWER_PCREL
// R_ADDRPOWER_TOCREL relocates two D-form instructions like R_ADDRPOWER, but
// inserts the offset from the TOC to the address of the relocated symbol
// rather than the symbol's address.
R_ADDRPOWER_TOCREL
// R_ADDRPOWER_TOCREL relocates a D-form, DS-form instruction sequence like
// R_ADDRPOWER_DS but inserts the offset from the TOC to the address of the
// relocated symbol rather than the symbol's address.
R_ADDRPOWER_TOCREL_DS
// RISC-V.
// R_RISCV_PCREL_ITYPE resolves a 32-bit PC-relative address using an
// AUIPC + I-type instruction pair.
R_RISCV_PCREL_ITYPE
// R_RISCV_PCREL_STYPE resolves a 32-bit PC-relative address using an
// AUIPC + S-type instruction pair.
R_RISCV_PCREL_STYPE
// R_PCRELDBL relocates s390x 2-byte aligned PC-relative addresses.
// TODO(mundaym): remove once variants can be serialized - see issue 14218.
R_PCRELDBL
// R_ADDRMIPSU (only used on mips/mips64) resolves to the sign-adjusted "upper" 16
// bits (bit 16-31) of an external address, by encoding it into the instruction.
R_ADDRMIPSU
// R_ADDRMIPSTLS (only used on mips64) resolves to the low 16 bits of a TLS
// address (offset from thread pointer), by encoding it into the instruction.
R_ADDRMIPSTLS
// R_ADDRCUOFF resolves to a pointer-sized offset from the start of the
// symbol's DWARF compile unit.
R_ADDRCUOFF
// R_WASMIMPORT resolves to the index of the WebAssembly function import.
R_WASMIMPORT
// R_XCOFFREF (only used on aix/ppc64) prevents garbage collection by ld
// of a symbol. This isn't a real relocation, it can be placed in anywhere
// in a symbol and target any symbols.
R_XCOFFREF
)
// IsDirectCall reports whether r is a relocation for a direct call.
// A direct call is a CALL instruction that takes the target address
// as an immediate. The address is embedded into the instruction, possibly
// with limited width. An indirect call is a CALL instruction that takes
// the target address in register or memory.
func (r RelocType) IsDirectCall() bool {
switch r {
case R_CALL, R_CALLARM, R_CALLARM64, R_CALLMIPS, R_CALLPOWER, R_CALLRISCV:
return true
}
return false
}
// IsDirectJump reports whether r is a relocation for a direct jump.
// A direct jump is a JMP instruction that takes the target address
// as an immediate. The address is embedded into the instruction, possibly
// with limited width. An indirect jump is a JMP instruction that takes
// the target address in register or memory.
func (r RelocType) IsDirectJump() bool {
switch r {
case R_JMPMIPS:
return true
}
return false
}
// IsDirectCallOrJump reports whether r is a relocation for a direct
// call or a direct jump.
func (r RelocType) IsDirectCallOrJump() bool {
return r.IsDirectCall() || r.IsDirectJump()
}

View File

@@ -0,0 +1,17 @@
// Code generated by "stringer -type=RelocType"; DO NOT EDIT.
package objabi
import "strconv"
const _RelocType_name = "R_ADDRR_ADDRPOWERR_ADDRARM64R_ADDRMIPSR_ADDROFFR_WEAKADDROFFR_SIZER_CALLR_CALLARMR_CALLARM64R_CALLINDR_CALLPOWERR_CALLMIPSR_CALLRISCVR_CONSTR_PCRELR_TLS_LER_TLS_IER_GOTOFFR_PLT0R_PLT1R_PLT2R_USEFIELDR_USETYPER_METHODOFFR_POWER_TOCR_GOTPCRELR_JMPMIPSR_DWARFSECREFR_DWARFFILEREFR_ARM64_TLS_LER_ARM64_TLS_IER_ARM64_GOTPCRELR_ARM64_GOTR_ARM64_PCRELR_ARM64_LDST8R_ARM64_LDST32R_ARM64_LDST64R_ARM64_LDST128R_POWER_TLS_LER_POWER_TLS_IER_POWER_TLSR_ADDRPOWER_DSR_ADDRPOWER_GOTR_ADDRPOWER_PCRELR_ADDRPOWER_TOCRELR_ADDRPOWER_TOCREL_DSR_RISCV_PCREL_ITYPER_RISCV_PCREL_STYPER_PCRELDBLR_ADDRMIPSUR_ADDRMIPSTLSR_ADDRCUOFFR_WASMIMPORTR_XCOFFREF"
var _RelocType_index = [...]uint16{0, 6, 17, 28, 38, 47, 60, 66, 72, 81, 92, 101, 112, 122, 133, 140, 147, 155, 163, 171, 177, 183, 189, 199, 208, 219, 230, 240, 249, 262, 276, 290, 304, 320, 331, 344, 357, 371, 385, 400, 414, 428, 439, 453, 468, 485, 503, 524, 543, 562, 572, 583, 596, 607, 619, 629}
func (i RelocType) String() string {
i -= 1
if i < 0 || i >= RelocType(len(_RelocType_index)-1) {
return "RelocType(" + strconv.FormatInt(int64(i+1), 10) + ")"
}
return _RelocType_name[_RelocType_index[i]:_RelocType_index[i+1]]
}

View File

@@ -0,0 +1,33 @@
// Copyright 2011 The Go Authors. All rights reserved.
// Use of this source code is governed by a BSD-style
// license that can be found in the LICENSE file.
package objabi
// For the linkers. Must match Go definitions.
const (
STACKSYSTEM = 0
StackSystem = STACKSYSTEM
StackBig = 4096
StackSmall = 128
)
const (
StackPreempt = -1314 // 0xfff...fade
)
// Initialize StackGuard and StackLimit according to target system.
var StackGuard = 928*stackGuardMultiplier() + StackSystem
var StackLimit = StackGuard - StackSystem - StackSmall
// stackGuardMultiplier returns a multiplier to apply to the default
// stack guard size. Larger multipliers are used for non-optimized
// builds that have larger stack frames or for specific targets.
func stackGuardMultiplier() int {
// On AIX, a larger stack is needed for syscalls.
if GOOS == "aix" {
return 2
}
return 1
}

View File

@@ -0,0 +1,79 @@
// Derived from Inferno utils/6l/l.h and related files.
// https://bitbucket.org/inferno-os/inferno-os/src/master/utils/6l/l.h
//
// Copyright © 1994-1999 Lucent Technologies Inc. All rights reserved.
// Portions Copyright © 1995-1997 C H Forsyth (forsyth@terzarima.net)
// Portions Copyright © 1997-1999 Vita Nuova Limited
// Portions Copyright © 2000-2007 Vita Nuova Holdings Limited (www.vitanuova.com)
// Portions Copyright © 2004,2006 Bruce Ellis
// Portions Copyright © 2005-2007 C H Forsyth (forsyth@terzarima.net)
// Revisions Copyright © 2000-2007 Lucent Technologies Inc. and others
// Portions Copyright © 2009 The Go Authors. All rights reserved.
//
// Permission is hereby granted, free of charge, to any person obtaining a copy
// of this software and associated documentation files (the "Software"), to deal
// in the Software without restriction, including without limitation the rights
// to use, copy, modify, merge, publish, distribute, sublicense, and/or sell
// copies of the Software, and to permit persons to whom the Software is
// furnished to do so, subject to the following conditions:
//
// The above copyright notice and this permission notice shall be included in
// all copies or substantial portions of the Software.
//
// THE SOFTWARE IS PROVIDED "AS IS", WITHOUT WARRANTY OF ANY KIND, EXPRESS OR
// IMPLIED, INCLUDING BUT NOT LIMITED TO THE WARRANTIES OF MERCHANTABILITY,
// FITNESS FOR A PARTICULAR PURPOSE AND NONINFRINGEMENT. IN NO EVENT SHALL THE
// AUTHORS OR COPYRIGHT HOLDERS BE LIABLE FOR ANY CLAIM, DAMAGES OR OTHER
// LIABILITY, WHETHER IN AN ACTION OF CONTRACT, TORT OR OTHERWISE, ARISING FROM,
// OUT OF OR IN CONNECTION WITH THE SOFTWARE OR THE USE OR OTHER DEALINGS IN
// THE SOFTWARE.
package objabi
// A SymKind describes the kind of memory represented by a symbol.
type SymKind uint8
// Defined SymKind values.
// These are used to index into cmd/link/internal/sym/AbiSymKindToSymKind
//
// TODO(rsc): Give idiomatic Go names.
//go:generate stringer -type=SymKind
const (
// An otherwise invalid zero value for the type
Sxxx SymKind = iota
// Executable instructions
STEXT
// Read only static data
SRODATA
// Static data that does not contain any pointers
SNOPTRDATA
// Static data
SDATA
// Statically data that is initially all 0s
SBSS
// Statically data that is initially all 0s and does not contain pointers
SNOPTRBSS
// Thread-local data that is initially all 0s
STLSBSS
// Debugging data
SDWARFCUINFO
SDWARFCONST
SDWARFFCN
SDWARFABSFCN
SDWARFTYPE
SDWARFVAR
SDWARFRANGE
SDWARFLOC
SDWARFLINES
// ABI alias. An ABI alias symbol is an empty symbol with a
// single relocation with 0 size that references the native
// function implementation symbol.
//
// TODO(austin): Remove this and all uses once the compiler
// generates real ABI wrappers rather than symbol aliases.
SABIALIAS
// Coverage instrumentation counter for libfuzzer.
SLIBFUZZER_EXTRA_COUNTER
// Update cmd/link/internal/sym/AbiSymKindToSymKind for new SymKind values.
)

View File

@@ -0,0 +1,41 @@
// Code generated by "stringer -type=SymKind"; DO NOT EDIT.
package objabi
import "strconv"
func _() {
// An "invalid array index" compiler error signifies that the constant values have changed.
// Re-run the stringer command to generate them again.
var x [1]struct{}
_ = x[Sxxx-0]
_ = x[STEXT-1]
_ = x[SRODATA-2]
_ = x[SNOPTRDATA-3]
_ = x[SDATA-4]
_ = x[SBSS-5]
_ = x[SNOPTRBSS-6]
_ = x[STLSBSS-7]
_ = x[SDWARFCUINFO-8]
_ = x[SDWARFCONST-9]
_ = x[SDWARFFCN-10]
_ = x[SDWARFABSFCN-11]
_ = x[SDWARFTYPE-12]
_ = x[SDWARFVAR-13]
_ = x[SDWARFRANGE-14]
_ = x[SDWARFLOC-15]
_ = x[SDWARFLINES-16]
_ = x[SABIALIAS-17]
_ = x[SLIBFUZZER_EXTRA_COUNTER-18]
}
const _SymKind_name = "SxxxSTEXTSRODATASNOPTRDATASDATASBSSSNOPTRBSSSTLSBSSSDWARFCUINFOSDWARFCONSTSDWARFFCNSDWARFABSFCNSDWARFTYPESDWARFVARSDWARFRANGESDWARFLOCSDWARFLINESSABIALIASSLIBFUZZER_EXTRA_COUNTER"
var _SymKind_index = [...]uint8{0, 4, 9, 16, 26, 31, 35, 44, 51, 63, 74, 83, 95, 105, 114, 125, 134, 145, 154, 178}
func (i SymKind) String() string {
if i >= SymKind(len(_SymKind_index)-1) {
return "SymKind(" + strconv.FormatInt(int64(i), 10) + ")"
}
return _SymKind_name[_SymKind_index[i]:_SymKind_index[i+1]]
}

View File

@@ -0,0 +1,40 @@
// Copyright 2012 The Go Authors. All rights reserved.
// Use of this source code is governed by a BSD-style
// license that can be found in the LICENSE file.
package objabi
// Must match runtime and reflect.
// Included by cmd/gc.
const (
KindBool = 1 + iota
KindInt
KindInt8
KindInt16
KindInt32
KindInt64
KindUint
KindUint8
KindUint16
KindUint32
KindUint64
KindUintptr
KindFloat32
KindFloat64
KindComplex64
KindComplex128
KindArray
KindChan
KindFunc
KindInterface
KindMap
KindPtr
KindSlice
KindString
KindStruct
KindUnsafePointer
KindDirectIface = 1 << 5
KindGCProg = 1 << 6
KindMask = (1 << 5) - 1
)

View File

@@ -0,0 +1,203 @@
// Copyright 2015 The Go Authors. All rights reserved.
// Use of this source code is governed by a BSD-style
// license that can be found in the LICENSE file.
package objabi
import (
"fmt"
"log"
"os"
"strings"
)
func envOr(key, value string) string {
if x := os.Getenv(key); x != "" {
return x
}
return value
}
var (
defaultGOROOT string // set by linker
GOROOT = envOr("GOROOT", defaultGOROOT)
GOARCH = envOr("GOARCH", "amd64")
GOOS = envOr("GOOS", "linux")
GO386 = envOr("GO386", "")
GOAMD64 = goamd64()
GOARM = goarm()
GOMIPS = gomips()
GOMIPS64 = gomips64()
GOPPC64 = goppc64()
GOWASM = gowasm()
GO_LDSO = ""
Version = ""
)
const (
ElfRelocOffset = 256
MachoRelocOffset = 2048 // reserve enough space for ELF relocations
Go115AMD64 = "alignedjumps" // Should be "alignedjumps" or "normaljumps"; this replaces environment variable introduced in CL 219357.
)
// TODO(1.16): assuming no issues in 1.15 release, remove this and related constant.
func goamd64() string {
return Go115AMD64
}
func goarm() int {
switch v := envOr("GOARM", "7"); v {
case "5":
return 5
case "6":
return 6
case "7":
return 7
}
// Fail here, rather than validate at multiple call sites.
log.Fatalf("Invalid GOARM value. Must be 5, 6, or 7.")
panic("unreachable")
}
func gomips() string {
switch v := envOr("GOMIPS", "hardfloat"); v {
case "hardfloat", "softfloat":
return v
}
log.Fatalf("Invalid GOMIPS value. Must be hardfloat or softfloat.")
panic("unreachable")
}
func gomips64() string {
switch v := envOr("GOMIPS64", "hardfloat"); v {
case "hardfloat", "softfloat":
return v
}
log.Fatalf("Invalid GOMIPS64 value. Must be hardfloat or softfloat.")
panic("unreachable")
}
func goppc64() int {
switch v := envOr("GOPPC64", "power8"); v {
case "power8":
return 8
case "power9":
return 9
}
log.Fatalf("Invalid GOPPC64 value. Must be power8 or power9.")
panic("unreachable")
}
type gowasmFeatures struct {
SignExt bool
SatConv bool
}
func (f gowasmFeatures) String() string {
var flags []string
if f.SatConv {
flags = append(flags, "satconv")
}
if f.SignExt {
flags = append(flags, "signext")
}
return strings.Join(flags, ",")
}
func gowasm() (f gowasmFeatures) {
for _, opt := range strings.Split(envOr("GOWASM", ""), ",") {
switch opt {
case "satconv":
f.SatConv = true
case "signext":
f.SignExt = true
case "":
// ignore
default:
log.Fatalf("Invalid GOWASM value. No such feature: " + opt)
}
}
return
}
func Getgoextlinkenabled() string {
return envOr("GO_EXTLINK_ENABLED", "")
}
func init() {
for _, f := range strings.Split("", ",") {
if f != "" {
addexp(f)
}
}
// regabi is only supported on amd64.
if GOARCH != "amd64" {
Regabi_enabled = 0
}
}
// Note: must agree with runtime.framepointer_enabled.
var Framepointer_enabled = GOARCH == "amd64" || GOARCH == "arm64" && (GOOS == "linux" || GOOS == "darwin")
func addexp(s string) {
// Could do general integer parsing here, but the runtime copy doesn't yet.
v := 1
name := s
if len(name) > 2 && name[:2] == "no" {
v = 0
name = name[2:]
}
for i := 0; i < len(exper); i++ {
if exper[i].name == name {
if exper[i].val != nil {
*exper[i].val = v
}
return
}
}
fmt.Printf("unknown experiment %s\n", s)
os.Exit(2)
}
var (
Fieldtrack_enabled int
Preemptibleloops_enabled int
Staticlockranking_enabled int
Regabi_enabled int
)
// Toolchain experiments.
// These are controlled by the GOEXPERIMENT environment
// variable recorded when the toolchain is built.
// This list is also known to cmd/gc.
var exper = []struct {
name string
val *int
}{
{"fieldtrack", &Fieldtrack_enabled},
{"preemptibleloops", &Preemptibleloops_enabled},
{"staticlockranking", &Staticlockranking_enabled},
{"regabi", &Regabi_enabled},
}
var defaultExpstring = Expstring()
func DefaultExpstring() string {
return defaultExpstring
}
func Expstring() string {
buf := "X"
for i := range exper {
if *exper[i].val != 0 {
buf += "," + exper[i].name
}
}
if buf == "X" {
buf += ",none"
}
return "X:" + buf[2:]
}